PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0002500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 427aa    MW: 45385.7 Da    PI: 5.5387
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0002500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.42e-18318351134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C +C +tkTp+WR gp g+ktLCnaCG++y++ +
  Spipo1G0002500 318 CMHCEVTKTPQWRAGPMGPKTLCNACGVRYKSGR 351
                     99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.8E-17312362IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.385316348IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-15316375No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14316349IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.81E-14317374No hitNo description
PfamPF003204.0E-16318351IPR000679Zinc finger, GATA-type
PROSITE patternPS003440318343IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MSKRLKVWSN EGRRDICAKK MAAEGGSWHE EVEKLCEDED LMAAVADRSI FSLDDINLDD  60
IFLDIKDADI SGFVADNPQA GLVASGNLHG SAAASVAVAV DASAAGSAVL PEGLLCDDID  120
VTQLEWLSNF CEESYSSDGL RFVPCNATVT FHVAGDGDGD GESKKMVNAA VTSDMVDQGL  180
IFRSSSPISV LEHGISPPNS FSTVTASSYT SSLSSPSSSS SSGTGCGTKM ATAAPRSPPE  240
PIIVPARSRS KRPRPPSFSE NESENAESDC PNKEEKKKKK KLKKKALSSA TADGGEEEEE  300
AAAVSSSSPS AGGGVRKCMH CEVTKTPQWR AGPMGPKTLC NACGVRYKSG RLFPEYRPAA  360
SPTFVATIHS NSHKKVVEMR NKVGQEPPAS EPGPRPLDVA AKSCELLEYL RRREWRTAER  420
HGILSE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246251RSRSKR
2250254KRPRP
3274281EKKKKKKL
4275283KKKKKKLKK
5275284KKKKKKLKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51693451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.24e-39GATA family protein